A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPP14. Source: E.coli Amino Acid Sequence: VHGVLINGLISALLGTKMPGPGCVFLSQEISFPAPLYIGEVVLASAEVKKL The RPP14 Recombinant Protein Antigen is derived from E. coli. The RPP14 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Gene ID (Entrez) : 11102
Méthode de purification : >80% by SDS-PAGE and Coomassie blue staining
Nom usuel : RPP14 Recombinant Protein Antigen
Contenu et stockage : Store at −20°C. Avoid freeze-thaw cycles
Formule : PBS and 1M Urea, pH 7.4
À utiliser avec (application) : Blocking/Neutralizing, Control
Alias de gène : EC 3.1.26.5, EC 4.2.1.-, FLJ31508, HsHTD2, P14,3-hydroxyacyl-[acyl-carrier-protein] dehydratase, ribonuclease P (14kD), ribonuclease P 14kDa subunit, ribonuclease P protein subunit p14, ribonuclease P/MRP 14kDa subunit
Symbole de gène(s) : RPP14
Type d’étiquette : Unlabeled
Type de produit : Recombinant Protein Antigen
Quantité : 100μL
État réglementaire : RUO
Source : E.coli
Réactivité spécifique : This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52970. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
