A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STRIP1.
Points forts
Amino Acid Sequence
DSIKVIRNMRAASPPASASDLIEQQQKRGRREHKALIKQDNLDAFNERDPYKADDSREEE The STRIP1 Recombinant Protein Antigen is derived from E. coli. The STRIP1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-043710 |
|---|
| Réf. fabricant | 18261983 |
|---|
| Gene ID (Entrez) | 85369 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | STRIP1 Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | FAM40A, Family With Sequence Similarity 40, Member A, FAR11 Factor Arrest 11 Homolog A, FAR11 Factor Arrest 11 Homolog A (Yeast), FAR11A, Homolog Of Yeast FAR11 Protein 1, KIAA1761, Protein FAM40A, Striatin Interacting Protein 1, Striatin-Interacting Prot |
|---|
| Symbole de gène(s) | FAM40A |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50450. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
