Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Bcl-6
Source: E.coli
EHVVDTCRKFIKASEAEMVSAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVR
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-046114 |
| Réf. fabricant | 18209239 |
| Gene ID (Entrez) | 604 |
| Pureté | >80% by SDS-PAGE and Coomassie blue staining |
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Antibody Competition |
| Alias de gène | B-cell CLL/lymphoma 6, B-cell lymphoma 6 protein transcript, BCL-5, BCL5B-cell lymphoma 5 protein, BCL-6, BCL6A, cys-his2 zinc finger transcription factor, LAZ3ZBTB27B-cell lymphoma 6 protein, lymphoma-associated zinc finger gene on chromosome 3, Protein LAZ-3, Zinc finger and BTB domain-containing protein 27, Zinc finger protein 51ZNF51, zinc finger transcription factor BCL6S |
| Symbole de gène(s) | BCL6 |
| Poids moléculaire | 29 kDa |
| Quantité | 100 μL |
| Source | E. coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55064. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
| Tampon de stockage | PBS and 1M Urea, pH 7.4. |
