A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PILR-alpha.
Points forts
Amino Acid Sequence
ALSSSTSPRAPPSHRPLKSPQNETLYSVLK The PILR-alpha Recombinant Protein Antigen is derived from E. coli. The PILR-alpha Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-046162 |
|---|
| Réf. fabricant | 18219804 |
|---|
| Gene ID (Entrez) | 29992 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | PILR-alpha Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles |
|---|
| Formule | PBS and 1M Urea, pH 7.4 |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | Cell surface receptor FDF03, FDF03, inhibitory receptor PILRalpha, Inhibitory receptor PILR-alpha, paired immunoglobin-like receptor alpha, paired immunoglobin-like type 2 receptor alpha, paired immunoglobulin-like receptor alpha, paired immunoglobulin-li |
|---|
| Symbole de gène(s) | PILRA |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52080. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
