A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human c-Myc.
Points forts
Amino Acid Sequence
QAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP The c-Myc Recombinant Protein Antigen is derived from E. coli. The c-Myc Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-046310 |
|---|
| Réf. fabricant | 18241991 |
|---|
| Gene ID (Entrez) | 4609 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | c-Myc Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | avian myelocytomatosis viral oncogene homolog, BHLHE39, bHLHe39MRTL, Class E basic helix-loop-helix protein 39, c-Myc, MYC, myc proto-oncogene protein, MYCC, myc-related translation/localization regulatory factor, Proto-oncogene c-Myc, Transcription facto |
|---|
| Symbole de gène(s) | MYC |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Catégorie de recherche | Autophagy, Cancer, Cancer Stem Cells, Cell Cycle and Replication, Chromatin Research, Core ESC Like Genes, Epigenetics, Epitope Tags, Stem Cell Markers, Transcription Factors and Regulators, Tumor Suppressors |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52956. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
