Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCOA3. The NCOA3/AIB1 Recombinant Protein Antigen is derived from E. coli. The NCOA3/AIB1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-90256. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-046417 |
| Réf. fabricant | 18345340 |
| Gene ID (Entrez) | 8202 |
| Espèces | Human |
| Méthode de purification | Chromatography |
| Pureté | >80% |
| Concentration | 0.5mg/mL |
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | ACTRCBP-interacting protein, AIB1AIB-1, Amplified in breast cancer 1 protein, BHLHE42, bHLHe42p/CIP, CAGH16, Class E basic helix-loop-helix protein 42, CTG26, KAT13B, MGC141848, NCoA-3, nuclear receptor coactivator 3, pCIP RAC-3, RAC3pCIP, Receptor-associated coactivator 3, SRC3, SRC-3EC 2.3.1.48, Steroid receptor coactivator protein 3, Thyroid hormone receptor activator molecule 1, TNRC16, TRAM1, TRAM-1TNRC14 |
| Symbole de gène(s) | NCOA3 |
| Type d’étiquette | Unlabeled |
| Poids moléculaire | 32kDa |
| Type de produit | NCOA3/AIB1 |
| Quantité | 0.1mL |
| État réglementaire | RUO |
| Source | E.Coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90256. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
| Immunogène | PSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVSSSTSGGVSSTSNMHGSLLQEKHRILHKLL |
