A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BAHCC1
Source: E.coli
Points forts
Amino Acid Sequence
SGLDKSGYFELPTSSQDCARPGHQDPLGGKAPQACCTLDKTVGKEAPAGPPGAQKVARIRHQQHLMAAEVEQGGIGAEAKRKSLELA
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-046538 |
|---|
| Réf. fabricant | 18167504 |
|---|
| Gene ID (Entrez) | 57597 |
|---|
| Pureté | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Antibody Competition |
|---|
| Alias de gène | BAH and coiled-coil domain-containing protein 1, BAH domain and coiled-coil containing 1, BAH domain-containing protein 2, BAHD2, bromo adjacent homology domain-containing protein 2, FLJ23058, KIAA1447 |
|---|
| Symbole de gène(s) | BAHCC1 |
|---|
| Poids moléculaire | 27 kDa |
|---|
| Quantité | 100 μL |
|---|
| Source | E. coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55048. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
| Tampon de stockage | PBS and 1M Urea, pH 7.4. |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
