A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Myosin light chain 3.
Points forts
Amino Acid Sequence
AKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIR The Myosin light chain 3 Recombinant Protein Antigen is derived from E. coli. The Myosin light chain 3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-047039 |
|---|
| Réf. fabricant | 18297262 |
|---|
| Gene ID (Entrez) | 4634 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | Myosin light chain 3 Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | Cardiac myosin light chain 1, CMH8Ventricular/slow twitch myosin alkali light chain, CMLC1, light polypeptide 3, alkali; ventricular, skeletal, slow, MLC1SBMyosin light chain 1, slow-twitch muscle B/ventricular isoform, MLC1V, myosin light chain 3, myosin |
|---|
| Symbole de gène(s) | MYL3 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50550. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
