Novus Biologicals™ Peptide bloquant d’anticorps Wnt-3a

Name: Novus Biologicals™ Peptide bloquant d’anticorps Wnt-3a
Brand: Novus Biologicals
SKU: 18285545
Price: 295.89 EUR
Availability: InStock

Réf. : BL-RE-047164Réf. fabricant : 18285545 100 μg

295,89 € HT

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Gene ID (Entrez): 89780
Espèces: Mouse
Contenu et stockage: Store at -20 C. Avoid freeze-thaw cycles.
Formule: Lyophilized from sterile distilled water.
À utiliser avec (application): This Peptide is Useful as a Blocking Peptide for NBP1-74183. This Synthetic Peptide is Designed for Use in an Antibody Competition Assay with Its Corresponding Antibody. Use of This Product in Any Other Assay Has Not Yet Been Tested. For Further Blocking Peptide Related Protocol, Click Here .
Marque: Novus Biologicals

Points forts

Source

Synthetic

Amino Acid Sequence

(Accession #: NP_033548) IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA. The Wnt-3a Blocking Peptide is derived from Synthetic. The Wnt-3a Blocking Peptide has been validated for the following applications: Antibody Competition.

Caractéristiques techniques

Marque	Novus Biologicals
Réf. B-LABO	BL-RE-047164
Réf. fabricant	18285545
Gene ID (Entrez)	89780
Espèces	Mouse
Contenu et stockage	Store at -20 C. Avoid freeze-thaw cycles.
Formule	Lyophilized from sterile distilled water.
À utiliser avec (application)	This Peptide is Useful as a Blocking Peptide for NBP1-74183. This Synthetic Peptide is Designed for Use in an Antibody Competition Assay with Its Corresponding Antibody. Use of This Product in Any Other Assay Has Not Yet Been Tested. For Further Blocking Peptide Related Protocol, Click Here .
Alias de gène	MGC119418, MGC119419, MGC119420, protein Wnt-3 A, wingless-type MMTV integration site family, member 3 A
Symbole de gène(s)	WNT3A
Type de produit	Wnt-3a
Quantité	100 μg
État réglementaire	RUO - research use only