Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMS19. The MMS19 like protein Recombinant Protein Antigen is derived from E. coli. The MMS19 like protein Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP2-47371. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-047754 |
| Réf. fabricant | 18181509 |
| Gene ID (Entrez) | 64210 |
| Espèces | Human |
| Méthode de purification | Chromatography |
| Pureté | >80% |
| Concentration | 0.5mg/mL |
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Symbole de gène(s) | MMS19 |
| Type d’étiquette | Unlabeled |
| Poids moléculaire | 28kDa |
| Type de produit | MMS19 like protein |
| Quantité | 0.1mL |
| État réglementaire | RUO |
| Source | E.Coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47371. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
| Immunogène | IVPLFLDGNVSFLPENSFPSRFQPFQDGSSGQRRLIALLMAFVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPA |
