A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TL1A/TNFSF15.
Points forts
Amino Acid Sequence
QLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQ The TL1A/TNFSF15 Recombinant Protein Antigen is derived from E. coli. The TL1A/TNFSF15 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-047984 |
|---|
| Réf. fabricant | 18237961 |
|---|
| Gene ID (Entrez) | 9966 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | TL1A/TNFSF15 Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | MGC129934, MGC129935, TL1A, TL1Vascular endothelial cell growth inhibitor, TNF superfamily ligand TL1A, tumor necrosis factor (ligand) superfamily, member 15, tumor necrosis factor ligand superfamily member 15, vascular endothelial growth inhibitor-192A, |
|---|
| Symbole de gène(s) | TNFSF15 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.Coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51505. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
