Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCL23. The CCL23/Ck beta 8-1/MIP3 Recombinant Protein Antigen is derived from E. coli. The CCL23/Ck beta 8-1/MIP3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-88079. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-048720 |
| Réf. fabricant | 18313990 |
| Gene ID (Entrez) | 6368 |
| Espèces | Human |
| Méthode de purification | Chromatography |
| Pureté | >80% |
| Concentration | 0.5mg/mL |
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | C6 beta-chemokine, chemokine (C-C motif) ligand 23, Ckb-8, CKb8, CK-beta-8, hmrp-2a, Macrophage inflammatory protein 3, MIP3, MIP-3CK-BETA-8, MPIF1, MPIF-1Ckb-8-1, Myeloid progenitor inhibitory factor 1, SCYA23C-C motif chemokine 23, small inducible cytokine subfamily A (Cys-Cys), member 23, Small-inducible cytokine A23 |
| Symbole de gène(s) | CCL23 |
| Type d’étiquette | Unlabeled |
| Poids moléculaire | 24kDa |
| Type de produit | CCL23/Ck beta 8-1/MIP3 |
| Quantité | 0.1mL |
| État réglementaire | RUO |
| Source | E.Coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88079. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
| Immunogène | NPVLLDMLWRRKIGPQMTLSHAAGFHATSADCCISYTPRSIPCSLLESYFETNS |
