A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Flt-3/Flk-2/CD135.
Points forts
Amino Acid Sequence
PGIPVDANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNRRPFSREMDLGLLS The Flt-3/Flk-2/CD135 Recombinant Protein Antigen is derived from E. coli. The Flt-3/Flk-2/CD135 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-049629 |
|---|
| Réf. fabricant | 18294452 |
|---|
| Gene ID (Entrez) | 2322 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | Flt-3/Flk-2/CD135 Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | CD135, CD135 antigen, EC 2.7.10, fetal liver kinase 2, FL cytokine receptor, FLK2, FLT-3, FLT3 receptor tyrosine kinase, Fms-like tyrosine kinase 3, fms-related tyrosine kinase 3, growth factor receptor tyrosine kinase type III, Stem cell tyrosine kinase |
|---|
| Symbole de gène(s) | FLT3 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51532. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
