A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Integrin alpha 4/CD49d
Source: E.coli
Points forts
Amino Acid Sequence
RLLYCIKADPHCLNFLCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKR
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-050176 |
|---|
| Réf. fabricant | 18137142 |
|---|
| Gene ID (Entrez) | 3676 |
|---|
| Pureté | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Antibody Competition |
|---|
| Alias de gène | 269C wild type, CD49 antigen-like family member D, CD49d, CD49d antigen, CD49Dantigen CD49D, alpha-4 subunit of VLA-4 receptor, IA4, integrin alpha 4, integrin alpha-4, integrin alpha-4 subunit, Integrin alpha-IV, integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor), MGC90518, very late activation protein 4 receptor, alpha 4 subunit, VLA-4 subunit alpha |
|---|
| Symbole de gène(s) | ITGA4 |
|---|
| Poids moléculaire | 28 kDa |
|---|
| Quantité | 100 μL |
|---|
| Source | E. coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55056. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
| Tampon de stockage | PBS and 1M Urea, pH 7.4. |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
