A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BCOR
Source: E.coli
Points forts
Amino Acid Sequence
LRVDRKRKVSGDSSHTETTAEEVPEDPLLKAKRRRVSKDDWPEREMTNSSSNHLEDPHYSELTNLKVCIELTGLHPKKQRHLLHLRERWEQQVSAADGKPG
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-051069 |
|---|
| Réf. fabricant | 18169584 |
|---|
| Gene ID (Entrez) | 54880 |
|---|
| Pureté | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Antibody Competition |
|---|
| Alias de gène | ANOP2, BCL6 corepressor, BCL-6 corepressor, BCL6 co-repressor, BCL-6 interacting corepressor, BCoR, FLJ20285, FLJ38041, KIAA1575MGC71031, MAA2, MCOPS2, MGC131961 |
|---|
| Symbole de gène(s) | BCOR |
|---|
| Poids moléculaire | 29 kDa |
|---|
| Quantité | 100 μL |
|---|
| Source | E. coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54977. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
| Tampon de stockage | PBS and 1M Urea, pH 7.4. |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
