Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WHSC1. The WHSC1 Recombinant Protein Antigen is derived from E. coli. The WHSC1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-82633. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-051348 |
| Réf. fabricant | 18363691 |
| Gene ID (Entrez) | 7468 |
| Espèces | Human |
| Méthode de purification | Chromatography |
| Pureté | >80% |
| Concentration | 0.5mg/mL |
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | EC 2.1.1.43, FLJ23286, IL5 promoter REII region-binding protein, KIAA1090, MGC176638, MMSETNSD2 multiple myeloma SET domain-containing protein, multiple myeloma SET domain containing protein type III, nuclear receptor binding SET domain protein 2 Nuclear SET domain-containing protein 2, probable histone-lysine N-methyltransferase NSD2, Protein trithorax-5, REIIBP, trithorax/ash1-related protein 5, TRX5, WHS, Wolf-Hirschhorn syndrome candidate 1, Wolf-Hirschhorn syndrome candidate 1 protein |
| Symbole de gène(s) | NSD2 |
| Type d’étiquette | Unlabeled |
| Poids moléculaire | 30kDa |
| Type de produit | WHSC1 |
| Quantité | 0.1mL |
| État réglementaire | RUO |
| Source | E.Coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82633. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
| Immunogène | SANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGD |
