Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human A-RAF.
E.coli
DSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDS The A-RAF Recombinant Protein Antigen is derived from E. coli. The A-RAF Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-051581 |
| Réf. fabricant | 18247353 |
| Gene ID (Entrez) | 369 |
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
| Nom usuel | A-RAF Recombinant Protein Antigen |
| Contenu et stockage | −20°C, avoid freeze-thaw cycles |
| Formule | PBS and 1M Urea, pH 7.4 |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | ARAF1A-RAF, EC 2.7.11, EC 2.7.11.1, Oncogene ARAF1, PKS, PKS2A-Raf proto-oncogene serine/threonine-protein kinase, Proto-oncogene A-Raf, Proto-oncogene A-Raf-1, Proto-oncogene Pks, RAFA1, Ras-binding protein DA-Raf, serine/threonine-protein kinase A-Raf, |
| Symbole de gène(s) | ARAF |
| Type d’étiquette | Unlabeled |
| Type de produit | Recombinant Protein Antigen |
| Quantité | 100μL |
| État réglementaire | RUO |
| Source | E.coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50085. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
