A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human beta-1,3-Glucuronyltransferase 1/B3GAT1.
Points forts
Amino Acid Sequence
LLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEVVRTEYVYTRPPPWSDTLPTI The beta-1,3-Glucuronyltransferase 1/B3GAT1 Recombinant Protein Antigen is derived from E. coli. The beta-1,3-Glucuronyltransferase 1/B3GAT1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-051618 |
|---|
| Réf. fabricant | 18232084 |
|---|
| Gene ID (Entrez) | 27087 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | beta-1,3-Glucuronyltransferase 1/B3GAT1 Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles |
|---|
| Formule | PBS and 1M Urea, pH 7.4 |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | Beta-1,3-glucuronyltransferase 1, beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P), EC 2.4.1.135, galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1, GlcAT-P, GLCATPGLCUATP, glcUAT-P, Glucuronosyltransferase P, NK1, NK-1, UDP- |
|---|
| Symbole de gène(s) | B3GAT1 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53156. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
