A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human N acetyl transferase 5.
Points forts
Amino Acid Sequence
LMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI The N acetyl transferase 5 Recombinant Protein Antigen is derived from E. coli. The N acetyl transferase 5 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-052997 |
|---|
| Réf. fabricant | 18247134 |
|---|
| Gene ID (Entrez) | 51126 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | N acetyl transferase 5 Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | dJ1002M8.1, dJ1175I6.2 (N-terminal acetyltransferase complex ard1 subunit), EC 2.3.1.88, homolog), N(alpha)-acetyltransferase 20, NatB catalytic subunit, N-acetyltransferase 3 homolog, N-acetyltransferase 5, N-acetyltransferase 5 (ARD1 homolog, S. cerevis |
|---|
| Symbole de gène(s) | NAA20 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52661. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
