Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AKT1. The AKT1 Recombinant Protein Antigen is derived from E. coli. The AKT1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-89159. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-053264 |
| Réf. fabricant | 18303550 |
| Gene ID (Entrez) | 207 |
| Espèces | Human |
| Méthode de purification | Chromatography |
| Pureté | >80% |
| Concentration | 0.5mg/mL |
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
| Formule | PBS, 1M Urea, pH 7.4 |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | AKT, AKT serine/threonine kinase 1, AKT1m, CWS6, EC 2.7.11, EC 2.7.11.1, PKB, PKB alpha, PKBMGC99656, PRKBA, Protein kinase B, Protein Kinase B Alpha, Proto-oncogene c-Akt, RAC, rac protein kinase alpha, RAC-ALPHA, RAC-alpha serine/threonine-protein kinase, RAC-PK-alpha, RACPKB-ALPHA, Serine-Threonine Protein Kinase, v-akt murine thymoma viral oncogene homolog 1, V-Akt Murine Thymoma Viral Oncogene-Like Protein 1 |
| Symbole de gène(s) | AKT1 |
| Type d’étiquette | Unlabeled |
| Poids moléculaire | 29kDa |
| Type de produit | Akt1 |
| Quantité | 0.1mL |
| État réglementaire | RUO |
| Source | E.Coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89159. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
| Tampon de stockage | PBS, 1M Urea, pH 7.4 |
| Immunogène | ERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVA |
