A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDK5 Activator 1.
Points forts
Amino Acid Sequence
FITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDK The CDK5 Activator 1 Recombinant Protein Antigen is derived from E. coli. The CDK5 Activator 1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-055729 |
|---|
| Réf. fabricant | 18245684 |
|---|
| Gene ID (Entrez) | 8851 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | CDK5 Activator 1 Recombinant Protein Antigen |
|---|
| Contenu et stockage | −20°C, avoid freeze-thaw cycles |
|---|
| Formule | PBS and 1M Urea, pH 7.4 |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | CDK5 activator 1, CDK5P35, CDK5R, cyclin-dependent kinase 5 activator 1, Cyclin-dependent kinase 5 regulatory subunit 1, cyclin-dependent kinase 5, regulatory subunit 1 (p35), MGC33831, NCK5A, neuronal CDK5 activator, p23, p25, p35, p35nck5a, regulatory p |
|---|
| Symbole de gène(s) | CDK5R1 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51019. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
