A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CARF/CDKN2AIP.
Points forts
Amino Acid Sequence
WANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDELVAKVKKRGISSSNEGVEEPSKKRVIEGKNSSAVEQDHAK The CARF/CDKN2AIP Recombinant Protein Antigen is derived from E. coli. The CARF/CDKN2AIP Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-083116 |
|---|
| Réf. fabricant | 18268981 |
|---|
| Gene ID (Entrez) | 55602 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | CARF/CDKN2AIP Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | CARFCDKN2A-interacting protein, CDKN2A interacting protein, collaborates/cooperates with ARF (alternate reading frame) protein, Collaborator of ARF, FLJ20036 |
|---|
| Symbole de gène(s) | CDKN2AIP |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.Coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52560. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
