Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A blocking peptide from human ZDHHC21.
Synthetic
(Accession #: NP_848661)ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV. The ZDHHC21 Blocking Peptide is derived from Synthetic. The ZDHHC21 Blocking Peptide has been validated for the following applications: Antibody Competition.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-083773 |
| Réf. fabricant | 18269254 |
| Gene ID (Entrez) | 340481 |
| Espèces | Human |
| Méthode de purification | Peptide affinity purified |
| Contenu et stockage | Store at -20 C. Avoid freeze-thaw cycles. |
| Formule | Lyophilized from sterile distilled water. |
| À utiliser avec (application) | This Peptide is Useful as a Blocking Peptide for NBP1-57049. This Synthetic Peptide is Designed for Use in an Antibody Competition Assay with Its Corresponding Antibody. Use of This Product in Any Other Assay Has Not Yet Been Tested. For Further Blocking Peptide Related Protocol, Click Here . |
| Alias de gène | DHHC-21, DNZ1, EC 2.3.1, EC 2.3.1.-, HSPC097, probable palmitoyltransferase ZDHHC21, Zinc finger DHHC domain-containing protein 21, zinc finger, DHHC domain containing 21, zinc finger, DHHC-type containing 21,9130404H11Rik |
| Symbole de gène(s) | ZDHHC21 |
| Poids moléculaire | 31kDa |
| Type de produit | ZDHHC21 |
| Quantité | 100 μg |
| État réglementaire | RUO - research use only |
| Consigne | Peptide sequence ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV |
