A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FANCM.
Points forts
Amino Acid Sequence
LAGTHTSLRLPQEGKGTCILVGGHEITSGLEVISSLRAIHGLQVEVCPLNGCDYIVSNRMVVERRSQSEMLNSVNKNKFIEQIQH The FANCM Recombinant Protein Antigen is derived from E. coli. The FANCM Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-084991 |
|---|
| Réf. fabricant | 18213154 |
|---|
| Gene ID (Entrez) | 57697 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | FANCM Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | ATP-dependent RNA helicase FANCM, EC 3.6.1, FAAP250EC 3.6.4.13, Fanconi anemia, complementation group M, Fanconi anemia-associated polypeptide of 250 kDa, KIAA1596Fanconi anemia group M protein, MGC176453, Protein FACM, Protein Hef ortholog |
|---|
| Symbole de gène(s) | FANCM |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Catégorie de recherche | DNA Repair, Epigenetics |
|---|
| Source | E.Coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51996. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
