Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CXCR2. The CXCR2/IL-8RB Recombinant Protein Antigen is derived from E. coli. The CXCR2/IL-8RB Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP2-38195. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-085535 |
| Réf. fabricant | 18186348 |
| Gene ID (Entrez) | 3579 |
| Espèces | Human |
| Méthode de purification | Chromatography |
| Pureté | >80% |
| Nom usuel | CXCR2/IL-8RB |
| Concentration | 0.5mg/mL |
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | CD182 antigen, CDw128b, chemokine (C-X-C motif) receptor 2, chemokine (CXC) receptor 2, C-X-C chemokine receptor type 2, CXC-R2, CXCR-2, CXCR2 gene for IL8 receptor type B, GRO/MGSA receptor, High affinity interleukin-8 receptor B, IL-8 receptor type 2, IL-8R B, IL8R2, IL8RA, interleukin 8 receptor B, interleukin 8 receptor type 2, interleukin-8 receptor type B |
| Symbole de gène(s) | CXCR2 |
| Type d’étiquette | Unlabeled |
| Poids moléculaire | 23kDa |
| Type de produit | CXCR2/IL-8 RB |
| Quantité | 0.1mL |
| État réglementaire | RUO |
| Source | E.Coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38195. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
| Immunogène | DFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINK |
